Everything below concerns analytical methods. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2026-08-01. Where a claim depends on a specific study, the study is described rather than over-claimed.
AOD-9604 drew attention in the 1990s and 2000s as a potential anti-obesity agent. Early work explored both injectable and oral routes, which is unusual for a peptide of this size. Animal studies reported changes in fat metabolism without the growth-promoting or insulin-like effects associated with full-length growth hormone. Subsequent human trials produced mixed or modest results, and the compound did not obtain regulatory approval for weight management in major markets. It remains known mainly through research literature, sports anti-doping listings, and non-approved supplement advertising.
AOD-9604 is prohibited in sport by the World Anti-Doping Agency under the peptide hormone class. Its presence in a sample can be detected through mass spectrometry-based methods, although the exact assay depends on the laboratory. In research settings, material is often supplied as a lyophilized powder for reconstitution. Buyers and researchers should note that products labeled AOD-9604 may vary in purity and actual peptide content. Analytical certificates and independent testing are common ways to verify identity, but no global harmonized standard exists for all commercial lots.
AOD-9604 is a synthetic peptide whose sequence is modeled on the C-terminal region of human growth hormone. Published descriptions commonly place it as a modified fragment corresponding to hGH amino acids 176–191, with a tyrosine residue added or retained at the N-terminus to support detection and handling. It is not intact growth hormone and lacks the full receptor-binding architecture of the parent protein. The molecule was developed as a research candidate for metabolic studies rather than as a replacement for growth hormone therapy. Its identity is defined by its amino acid sequence rather than by any single commercial preparation.
Quality varies among research-grade suppliers, so certificates of analysis and independent testing are important for verification. A typical certificate reports purity by HPLC, identity by mass spectrometry, appearance, and sometimes residual solvents or water content. AOD9604 is often sold as a research chemical not intended for human consumption, and labels can be inaccurate. Common misconceptions include treating the peptide as a form of growth hormone, assuming supplement status, or expecting approved-drug quality from unregulated products.
AOD9604 is commonly supplied as a white to off-white lyophilized powder. The powder is typically stored at -20 °C or below, protected from light and moisture, because peptides can degrade through oxidation, hydrolysis, or aggregation. If it is reconstituted for laboratory use, an appropriate aqueous buffer or solvent is chosen, and the solution is kept cold and handled to avoid repeated freeze-thaw cycles. These practices support stability but do not imply suitability for human use.
Identity and purity are usually assessed with reversed-phase high-performance liquid chromatography and mass spectrometry. Reversed-phase HPLC separates the peptide from related impurities and can estimate purity by ultraviolet absorbance, while mass spectrometry confirms the molecular mass and detects modifications. Peptide mapping, amino acid analysis, and disulfide mapping may be used when the sequence or disulfide arrangement must be verified. Because AOD9604 contains cysteine residues, oxidation and disulfide isomers are possible quality concerns in synthetic batches.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Synthetic peptide | Fragment analog of human growth hormone |
| Sequence basis | hGH 176–191 region | Modified C-terminal fragment |
| Common synonyms | AOD-9604; AOD9604; hGH fragment | Research and trade names vary |
| Regulatory status | Not approved as a drug | Prohibited in competitive sport |
| Research code | AOD9604 | Used in scientific and patent literature |
Early interest in AOD-9604 centered on whether a fragment of human growth hormone could influence fat metabolism without the broader effects of the full hormone. Cell and animal studies reported changes in fat storage and breakdown. Human trials followed, but the results were not strong enough to secure regulatory approval. The compound remains available for laboratory research, and its clinical potential is still described as uncertain. Studies continue to examine its activity and safety profile.
AOD-9604 is a synthetic peptide that corresponds to a short section of human growth hormone. It is commonly identified as hGH fragment 176-191 because its sequence matches residues at the C-terminal end of the hormone. The molecule contains sixteen amino acids and is made by solid-phase peptide synthesis. Researchers study it for metabolic effects rather than for the growth-promoting actions associated with full human growth hormone. Its small size distinguishes it from the complete 191-amino-acid hormone.
Research has examined whether the peptide affects fat mass independently of growth hormone's other actions. Early animal studies suggested reductions in body fat, but species differences and small sample sizes limit interpretation. Human studies have generally been short and have not consistently shown large effects. Some trials measured body composition, lipid profiles, and safety parameters, but the overall picture is one of suggestive yet inconclusive metabolic activity. Findings vary across study populations and protocols.
A central uncertainty is whether observed metabolic changes translate into meaningful clinical benefits. Study designs vary in dose, duration, and participant characteristics, making comparisons difficult. Independent replication is limited, and the field lacks consensus on optimal endpoints or treatment duration. Ongoing or future studies may clarify mechanism and effect size, but current evidence does not establish a clear therapeutic role. Researchers often call for larger, longer, and better-controlled trials, while questions remain about which patient groups might respond.
Proposed mechanism focuses on lipolysis, the breakdown of stored triglycerides into free fatty acids and glycerol. AOD-9604 is thought to act on adipose tissue without stimulating appetite or affecting blood sugar in the same way as growth hormone. Laboratory studies report increased fat oxidation in some models. The precise receptor interactions and signaling pathways remain incompletely characterized. Researchers have proposed that the peptide may influence fat mobilization through pathways distinct from the full hormone.
AOD-9604 has been investigated mainly in the context of body fat and metabolic endpoints. Some early animal and small human studies reported changes in fat mass or lipid markers, but findings were not uniform. Larger, well-controlled trials that would establish efficacy are lacking in the public literature. As a result, claims about weight loss or metabolic benefit remain investigational rather than established. The distinction between a research finding and a proven clinical outcome is central to discussing this peptide.
Regulatory bodies have taken different approaches to AOD-9604. It is not approved as a prescription medicine by major agencies such as the U.S. Food and Drug Administration or the European Medicines Agency. In sport, the World Anti-Doping Agency prohibits peptide hormones, growth factors, and related substances, and AOD-9604 has been treated as a prohibited substance. These regulatory decisions reflect concerns about safety, efficacy, and potential misuse rather than proof of benefit.
The pia mater (Latin: tender mother) is a very delicate membrane. It is the meningeal envelope that firmly adheres to the surfaces of the brain and spinal cord, following all of the brain's contours (gyri and sulci). It is a very thin sheet of connective tissue that interfaces with the glial limitans superficialis but lacks capillaries itself.
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
Various attempts have been made to express the "quality" or "value" of various kinds of protein. Measures include the biological value, net protein utilization, protein efficiency ratio, protein digestibility corrected amino acid score and the complete proteins concept. These concepts are important in the livestock industry, because the relative lack of one or more of the essential amino acids in animal feeds would have a limiting effect on growth and thus on feed conversion ratio. Thus, various feedstuffs may be fed in combination to increase net protein utilization, or a supplement of an individual amino acid (methionine, lysine, threonine, or tryptophan) can be added to the feed.
=== Critical regime === For Reynolds numbers in the range 2000 < Re < 4000, the flow is unsteady (varies grossly with time) and varies from one section of the pipe to another (is not "fully developed"). The flow involves the incipient formation of vortices; it is not well understood.
Combating Terrorism Center: 20–23. Hitti, Philip K. (1966). The Origins of the Druze People: With Extracts from Their Sacred Writings. AMS Press. Kratschkowsky, I. & Halm, Heinz (1993). "al-Muḳtanā". In Bosworth, C. E.; van Donzel, E.; Heinrichs, W. P. & Pellat, Ch. (eds.). The Encyclopaedia of Islam, Second Edition. Volume VII: Mif–Naz. Leiden: E. J. Brill. p. 544. doi:10.1163/1573-3912_islam_SIM_5483. ISBN 978-90-04-09419-2. Van Leeuwen, Richard (1994). Notables and Clergy in Mount Lebanon: The Khāzin Sheikhs and the Maronite Church, 1736–1840. BRILL. ISBN 978-90-04-09978-4. Levi Della Vida, G. (2000). "Taym Allah". In Bearman, P. J.; Bianquis, Th.; Bosworth, C. E.; van Donzel, E. & Heinrichs, W. P. (eds.). The Encyclopaedia of Islam, Second Edition. Volume X: T–U. Leiden: E. J. Brill. pp. 400–401. ISBN 978-90-04-11211-7. Makarim, Sami Nasib (1974). The Druze Faith. Caravan Books. ISBN 978-0-88206-003-3. McGrath, Alister E. (2006). Christianity: An Introduction. John Wiley & Sons. pp. 4–6. ISBN 978-1-4051-0899-7. Archived from the original on September 10, 2015. Retrieved August 14, 2015. Mishaqa, Mikhail (1988). Thackston, Wheeler McIntosh (ed.). Murder, Mayhem, Pillage, and Plunder: The History of the Lebanon in the 18th and 19th Centuries by Mikhayil Mishaqa (1800-1873). State University of New York Press. ISBN 978-0-88706-712-9. Morgenstern, Julian (1966). The Rites of Birth, Marriage, Death, and Kindred Occasions Among the Semites. Hebrew Union College Press. Olsaretti, Alessandro (December 2008). "Political Dynamics in the Rise of Fakhr al-Din, 1590-1633".
Sources: en.wikipedia.org
1632–1723: Antonie van Leeuwenhoek taught himself to make lenses, constructed basic optical microscopes and drew protozoa, such as Vorticella from rain water, and bacteria from his own mouth. 1665: Robert Hooke discovered cells in cork, then in living plant tissue using an early microscope. In his book Micrographia he coined the term cell (from Latin cellula, meaning "small room") since they resembled the cells of a monastery. 1839: Theodor Schwann and Matthias Jakob Schleiden elucidated the principle that plants and animals are made of cells, concluding that cells are a common unit of structure and development, founding the cell theory. 1855: Rudolf Virchow stated that new cells come from pre-existing cells by cell division (omnis cellula ex cellula). 1931: Ernst Ruska built the first transmission electron microscope at the University of Berlin. By 1935, he had built an electron microscope with twice the resolution of a light microscope, revealing previously unresolvable organelles. 1981: Lynn Margulis published Symbiosis in Cell Evolution detailing how eukaryotic cells were created by symbiogenesis.
== Structure == In bacteria, HDH is a single chain polypeptide; in fungi it is the C-terminal domain of a multifunctional enzyme which catalyses three different steps of histidine biosynthesis; and in plants it is expressed as a nuclear encoded protein precursor which is exported to the chloroplast.
Glycoproteins have differential levels of glycosylations and adsorb SDS more unevenly at the glycosylations, resulting in broader and blurred bands. Membrane proteins, because of their transmembrane domain, are often composed of the more hydrophobic amino acids, have lower solubility in aqueous solutions, tend to bind lipids, and tend to precipitate in aqueous solutions due to hydrophobic effects when sufficient amounts of detergent are not present. This precipitation manifests itself for membrane proteins in a SDS-PAGE in "tailing" above the band of the transmembrane protein. In this case, more SDS can be used (by using more or more concentrated sample buffer) and the amount of protein in the sample application can be reduced. An overloading of the gel with a soluble protein creates a semicircular band of this protein (e. g. in the marker lane of the image at 66 kDa), allowing other proteins with similar molecular weights to be covered. A low contrast (as in the marker lane of the image) between bands within a lane indicates either the presence of many proteins (low purity) or, if using purified proteins and a low contrast occurs only below one band, it indicates a proteolytic degradation of the protein, which first causes degradation bands, and after further degradation produces a homogeneous color ("smear") below a band. The documentation of the banding pattern is usually done by photographing or scanning. For a subsequent recovery of the molecules in individual bands, a gel extraction can be performed.
In many-body potentials, the potential energy includes the effects of three or more particles interacting with each other. In simulations with pairwise potentials, global interactions in the system also exist, but they occur only through pairwise terms. In many-body potentials, the potential energy cannot be found by a sum over pairs of atoms, as these interactions are calculated explicitly as a combination of higher-order terms. In the statistical view, the dependency between the variables cannot in general be expressed using only pairwise products of the degrees of freedom. For example, the Tersoff potential, which was originally used to simulate carbon, silicon, and germanium, and has since been used for a wide range of other materials, involves a sum over groups of three atoms, with the angles between the atoms being an important factor in the potential. Other examples are the embedded-atom method (EAM), the EDIP, and the Tight-Binding Second Moment Approximation (TBSMA) potentials, where the electron density of states in the region of an atom is calculated from a sum of contributions from surrounding atoms, and the potential energy contribution is then a function of this sum.
== Past events == In the 19th and early 20th centuries asbestos was used in many products and in building construction and was not considered a threat to human health or the environment. Deaths and lung problems caused by asbestos were first documented in the early 20th century. The first regulations of the asbestos industry were published in the UK in the 1930s. Regulation of asbestos in the US did not occur until the 1980s. In the 1970s there was a serious issue with the water treatment infrastructure of some US states, notably in Southern California with water sourced from the Sacramento–San Joaquin River Delta. Water was being disinfected for domestic use through chlorine treatment, which was effective for killing microbial contaminants and bacteria, but in some cases, it reacted with runoff chemicals and organic matter to form trihalomethanes (THMs). Research done in the subsequent years began to suggest the carcinogenic and harmful nature of this category of compounds. EPA issued its first standard for THMs, applicable to public water systems, in 1979, and more stringent standards in 1998 and 2006. Rapid industry changes also make the treatment and regulation of CEC particularly challenging. For instance, the replacing substance (GenX), for the recently regulated perfluorooctanoic acid (PFOA), a PFAS, had a more detrimental environmental impact, resulting in the subsequently banning of GenX as well. Hence, there is a pressing need for the treatment and management of CEC to keep up with global trends.
Sources: en.wikipedia.org
No. It is a synthetic peptide fragment modeled on part of human growth hormone, not the full hormone. It does not contain the complete sequence or receptor-binding regions of hGH.
It was investigated in clinical trials for obesity, but it did not receive approval for that use in major markets. Results were generally modest or mixed, and it remains an experimental compound.
WADA lists it as a prohibited peptide hormone. Its use can be detected by laboratory methods, and athletes are subject to sanctions if it is found in samples.
Lyophilized AOD9604 is generally kept at -20 °C or colder, desiccated, and protected from light. Reconstituted solutions are usually refrigerated and handled to minimize repeated freeze-thaw cycles. These are general laboratory handling practices, not instructions for human use.